Experimental laboratory research only · Not for human use
Home / Catalog / CJC-1295 without DAC
CJC-1295 without DAC 2 mg per vial, CND2, Gala kit packaging concept with 10 unbranded vials; actual parcel supplied unbranded
CJC-1295 without DAC · CND2 · 2 mg per vialPackaging concept · supplied unbranded · kit of 10

Compound reference

Specifications

Also known as
Modified GRF (1-29) · Mod GRF 1-29 · Tetrasubstituted GRF(1-29)
Molecular formula
C152H252N44O42
Molecular weight
3367.9 g/mol
Sequence
YADAIFTQSYRKVLAQLSARKLLQDILSR-NH2 (position 2 = D-Ala)
Research area
GH secretagogue
Form
Lyophilised powder

Reference identifiers describe the named compound; they do not verify a supplier lot or its salt form.

Research kit / CND2

CJC-1295 without DAC

Four-residue-substituted analogue of GHRH(1-29) without a drug-affinity complex, studied for stimulation of pulsatile growth hormone release in preclinical models.

Amount per vial
2 mg5 mg10 mg
SKU
CND2
Amount per vial
2 mg
Unit of sale
Kit of 10 vials
$82USD / KIT

Shipping excluded. Supplied in plain, unbranded packaging.

Lot documentation

Certificate of analysis available on request for selected lots.

Experimental laboratory research only.
Not for human or animal use.

All kit prices
SKUPer vialUSD / kit
CND22 mg$82
CND55 mg$160
CND1010 mg$300

Research supply / 21+

Before you enter.

This catalog is for visitors aged 21 or older. All products are for experimental laboratory research only, not for human or animal use.

Your age confirmation is remembered on this device.