Compound reference
Specifications
- Also known as
- AM833 · NN0174-0833 · GLXC-26801
- CAS number
- 1415456-99-3
- Molecular formula
- C194H312N54O59S2
- Molecular weight
- 4409.1 g/mol
- Sequence
- (Eicosanedioic acid-γGlu)-KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2
- Research area
- Metabolic / incretin
- Form
- Lyophilised powder
Reference identifiers describe the named compound; they do not verify a supplier lot or its salt form.
Research kit / CGL5
Cagrilintide
Long-acting acylated analogue of amylin studied in models of appetite regulation and body-weight control.
- SKU
- CGL5
- Amount per vial
- 5 mg
- Unit of sale
- Kit of 10 vials
≈ $22 per vial
Shipping excluded. Supplied in plain, unbranded packaging.
Lot documentation
Certificate of analysis available on request for selected lots.
Experimental laboratory research only.
Not for human or animal use.
All kit prices
| SKU | Per vial | USD / kit |
|---|---|---|
| CGL5 | 5 mg | $216≈ $22 per vial |
| CGL10 | 10 mg | $380≈ $38 per vial |
Research reference
Reconstitution concentration
Concentration maths for laboratory solutions. Use the mass of one vial and the final solution volume.
Prefilled from the selected SKU. For blends, this is the total mass per vial.
Assumes the entered volume equals the final prepared solution volume.
Enter positive values to calculate.
For experimental laboratory research only. Solubility and storage depend on the compound and lot.